PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 384aa    MW: 41717.4 Da    PI: 9.7801
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021369genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.14.4e-14298353560
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk+ l el+ + ++  
  Lus10021369 298 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENNQLKQALVELERKRKQKN 353
                  79********************************************9999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-12294358IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.714296348IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-13298351No hitNo description
PfamPF001708.0E-12298352IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.6E-10298347No hitNo description
CDDcd147072.23E-23298352No hitNo description
PROSITE patternPS000360301316IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MVATLPDQDM NSQGDQVDSP LQQLNHQSNK NQPSTTPLGR QSSIYSLTLD EFQHTLCEGG  60
KNFGSMNMDE FINSIWTAEE NQGAGHTSNS ATPVVNNHHS GRDTANPAGS GISKQPSLPR  120
QGSLTLPEKL CRKTVDEVWS EIHNGRGSRS GQRKSSDAAT NSGADMQNAG SVPRQPTFGE  180
MTLEDFLVKA GVVRGQQQQG GGGSSIAAAS IPPAPPQYSS VYQNPVAAYQ SILPHVQPGD  240
VYGTSGVGYA VVRPNSPVSS DGMLGNMDGV GNQYGMDMGG LRGRKRVIDG PVEKVVERRQ  300
RRMIKNRESA ARSRARKQAY TVELEAELNQ LKEENNQLKQ ALVELERKRK QKNVEEARTR  360
GPSKAQKARE NLRLMRRNLS CPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066490.11e-133PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ9SJN01e-107ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A067L6C21e-133A0A067L6C2_JATCU; Uncharacterized protein
STRINGSolyc09g009490.2.11e-123(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-107bZIP family protein